PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00568.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 330aa    MW: 37003 Da    PI: 6.9844
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00568.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Rsa1.0_00568.1_g00015.1 14 KGPWTPEEDIILVTYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                             79******************************99************97 PP

2Myb_DNA-binding50.16.2e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Rsa1.0_00568.1_g00015.1  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.078961IPR017930Myb domain
SuperFamilySSF466891.98E-3011108IPR009057Homeodomain-like
SMARTSM007171.6E-141363IPR001005SANT/Myb domain
PfamPF002495.8E-161461IPR001005SANT/Myb domain
CDDcd001671.15E-101661No hitNo description
PROSITE profilePS5129423.73962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2465117IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
PfamPF002493.2E-1467112IPR001005SANT/Myb domain
CDDcd001673.52E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MVRPPCCDKG GVKKGPWTPE EDIILVTYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLNKAN  120
QDSHQELDHS RDRSSLSSSP SSSSANSNSN ISRGQWERRL QTDIQLAKKA LSEALSPALE  180
PSINSTLATT ATESSSSESR RSTSSACEFL RTQETTTTYA SSTENIAKLL KGWVKTSRKT  240
QNSADQRIHP DSETKEVIKS DDVEIDCAEA FQAFSGFDHS KDCGSPDHET KPDINGCSNQ  300
SQLYLFEKWL FEDSGGQIGD ILLDENSNFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-25141164105MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529560.0AK352956.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-09-D13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607028.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU70.0MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A0D3E0L50.0A0A0D3E0L5_BRAOL; Uncharacterized protein
STRINGBra025361.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-161myb domain protein 30